Bacterial Pesticidal Protein Database






Search Database


Paste amino acid sequence (in plain or fasta format) into the box below

>Name
MDNNPNINECIPYNCLSNPEVEVLGGERIETGYTPIDISLSLTQFL ...

Query sequence 
Use example sequence